Description
VIP (vasoactive intestinal peptide) is a 28-residue neuropeptide discovered in 1970 that turned out to act far beyond the gut, in blood vessels, airways, immune cells and the brain’s master clock. It is a standard reference compound for VPAC-receptor research. Pure Peptides Canada supplies it as a lyophilized research reagent in 6 mg vials, with an independent Janoshik HPLC and mass-spectrometry report, CAD pricing and tracked shipping from inside Canada.
VIP at a glance
- What it is: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, a member of the secretin/glucagon peptide family, closely related to PACAP.
- What researchers study: VPAC1 and VPAC2 receptor signalling, smooth-muscle relaxation and vasodilation, circadian rhythm in the suprachiasmatic nucleus and anti-inflammatory immune effects.
- Evidence level: extensive cell and animal work plus human trials of the synthetic form, aviptadil. Not authorized in Canada.
- Supplied as: sealed lyophilized powder, 6 mg, single vial or box of 10.
- Delivery: ships from inside Canada by tracked Xpresspost in 3–7 days ($25 CAD), or free in 4–12 days on orders over $299.
VIP
Vasoactive intestinal peptide · aviptadil (synthetic) · VPAC1/VPAC2 agonist
- H
- S
- D
- A
- V
- F
- T
- D
- N
- Y
- T
- R
- L
- R
- K
- Q
- M
- A
- V
- K
- K
- Y
- L
- N
- S
- I
- L
- N
- NH₂
Human VIP, N-terminus to C-terminus. Outlined: C-terminal amide.
- Length
- 28 amino acids, C-terminal amide
- Molecular formula
- C147H238N44O42S
- Molecular weight
- ≈ 3326 g/mol
- CAS number
- 37221-79-7
- Receptors
- VPAC1, VPAC2 (class B GPCRs)
- Form
- Lyophilized powder, sealed vial
- Sizes
- 6 mg (single or box of 10)
- SKU
- PP-VIP
Where the evidence stands
- Cell studies
- Animal models
- Controlled human trials
- Approved in Canada
Synthetic VIP (aviptadil) has been studied in human trials and appears in a combination product registered in some European countries. Not authorized in Canada.
What is VIP?
In 1970 Sami Said and Viktor Mutt at the Karolinska Institute isolated a peptide from pig intestine that dilated blood vessels, and named it vasoactive intestinal peptide. It soon became clear the name undersold it. VIP is made by neurons throughout the body and brain, where it acts as a neurotransmitter and neuromodulator, and by immune cells, where it damps inflammation.
VIP signals through two class B G-protein-coupled receptors, VPAC1 and VPAC2, raising cAMP in target cells. Research has linked it to relaxation of airway and gut smooth muscle, intestinal secretion, regulatory T-cell function, and synchronizing the circadian clock in the suprachiasmatic nucleus. A synthetic form, aviptadil, has been tested in human trials, including for respiratory failure. VIP breaks down within minutes in blood, which is part of why it remains mainly a research tool.
What VIP research looks at
- Receptor pharmacology: VPAC1 and VPAC2 binding and cAMP signalling, and comparisons with PACAP.
- Smooth muscle and vasculature: relaxation and vasodilation in airway, gut and vascular preparations.
- Immune regulation: anti-inflammatory cytokine shifts and regulatory T-cell induction.
- Circadian biology: VIP signalling between neurons of the suprachiasmatic nucleus.
- Peptide stability: rapid degradation and the design of more stable analogues.
Regulatory status: VIP and aviptadil are not authorized drugs in Canada. We sell VIP strictly as a laboratory reagent for in-vitro research.
Why researchers order VIP from Pure Peptides Canada
Add a 6 mg vial or a box of 10 above. Orders over $299 ship free across Canada.
See lab resultsVIP FAQ
Where can I buy VIP peptide in Canada?
Pure Peptides Canada stocks vasoactive intestinal peptide as a lyophilized research reagent in 6 mg vials and ships it from inside Canada by tracked Xpresspost in 3–7 days ($25 CAD), or free in 4–12 days on orders over $299.
What is the difference between VIP and aviptadil?
Aviptadil is the drug name for synthetic VIP with the same sequence. This listing is a research reagent, not the medicine.
How is VIP related to PACAP?
Both belong to the secretin/glucagon peptide family and share the VPAC1 and VPAC2 receptors. PACAP also binds its own receptor, PAC1, which VIP binds only weakly.
Is this VIP third-party tested?
Yes. An HPLC purity and mass-spectrometry identity report from Janoshik Analytical, an independent lab, is listed on our Lab Testing page. Our COA guide explains how to read it.
Can VIP be used in people or animals?
No. This product is for in-vitro laboratory research only and is not a drug, supplement or food. We do not provide dosing or administration information.
For laboratory research use only. Not a drug, supplement, food or cosmetic, not for human or veterinary use, and not intended to diagnose, treat, cure or prevent any disease.
Ben –
Had some sort of mold infection from my ex apartment and this helped clear that stuff out once I moved out. Trust me you do not want to experience life with mold. 5 stars from me on this product!
James Wright –
pretty good product